Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium sp. (strain NGR234)
Uniprot NO.:P55581
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIVATLTPLWPLLDAEERPAVVSEVARSVTRSIALAPFHIRFAVESVSIVIGLCTVLISA GAGGPLARTLRTDRFYRLLQRMPGPAGSVIRLYRSMTLLAFYDEAPVAEKLLAARPAQTS
Protein Names:Recommended name: Uncharacterized protein y4nI
Gene Names:Ordered Locus Names:NGR_a02330 ORF Names:y4nI
Expression Region:1-120
Sequence Info:full length protein