
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium sp. (strain NGR234)
Uniprot NO.:P55450
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIH AQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALP ALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVC LGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQ HLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD
Protein Names:Recommended name: Uncharacterized protein y4fL
Gene Names:Ordered Locus Names:NGR_a03700 ORF Names:y4fL
Expression Region:1-275
Sequence Info:full length protein
You may also like
-
Recombinant Rhizobium sp. Uncharacterized protein y4yQ (NGR_a00540)
- Regular price
- $1,399.00 USD
- Sale price
- $1,399.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rhizobium sp. Uncharacterized protein y4jE (NGR_a03110)
- Regular price
- $1,379.00 USD
- Sale price
- $1,379.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rhizobium sp. Uncharacterized protein y4fD (NGR_a03770)
- Regular price
- $1,331.00 USD
- Sale price
- $1,331.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rhizobium sp. Uncharacterized protein y4yS (NGR_a00520)
- Regular price
- $1,297.00 USD
- Sale price
- $1,297.00 USD
- Regular price
-
- Unit price
- per
Sold out