Recombinant Rhizobium meliloti UDP-glucuronate 5'-epimerase(lspL)

CSB-EP526307RKU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O54067

Gene Names: lspL

Organism: Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

AA Sequence: MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNGRPIDIYGEGRMSRDFTYIDDLVESIVRLSHVPPSEENRVAPEKATDTLSRHAPFRVVNTGGGQPVELMTFVETVEKAVGRPAIHNMLPMQQGDVPRTFASPDLLEALTGFKPSVSVEEGVARFVEWYDQNYRRAHTTV

Expression Region: 1-341aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 54.1 kDa

Alternative Name(s): UDP-glucuronic acid epimerase

Relevance: UDP-glucuronate = UDP-L-iduronate

Reference: "Novel rkp gene clusters of Sinorhizobium meliloti involved in capsular polysaccharide production and invasion of the symbiotic nodule: the rkpK gene encodes a UDP-glucose dehydrogenase."Kereszt A., Kiss E., Reuhs B.L., Carlson R.W., Kondorosi A., Putnoky P.J. Bacteriol. 180:5426-5431(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.