Recombinant Rat Phospholipase A2, membrane associated(Pla2g2a)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Phospholipase A2, membrane associated(Pla2g2a)

CSB-EP321246RA
Regular price
$973.00 USD
Sale price
$973.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P14423

Gene Names: Pla2g2a

Organism: Rattus norvegicus (Rat)

AA Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Expression Region: 22-146aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.1 kDa

Alternative Name(s): GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2A

Relevance: Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: Structure of cDNA coding for rat platelet phospholipase A2.Komada M., Kudo I., Mizushima H., Kitamura N., Inoue K.J. Biochem. 106:545-547(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Phospholipase A2, membrane associated(Pla2g2a)
    Regular price
    $970.00 USD
    Sale price
    $970.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Phospholipase A2, membrane associated protein(PLA2G2A)
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Calcium-dependent phospholipase A2(Pla2g5)
    Regular price
    $973.00 USD
    Sale price
    $973.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Calcium-dependent phospholipase A2(Pla2g5)
    Regular price
    $973.00 USD
    Sale price
    $973.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share