Recombinant Rat PDZK1-interacting protein 1(Pdzk1ip1)

Recombinant Rat PDZK1-interacting protein 1(Pdzk1ip1)

CSB-CF846060RA
Regular price
$1,086.00 USD
Sale price
$1,086.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q923S2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLALSLLALGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEQE PGSTMMITGNKADGVLVGMDGRYSSMASGFRSSEHKNAFENVLEEEGRVRSTPM

Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein

Gene Names:Name:Pdzk1ip1 Synonyms:Map17

Expression Region:1-114

Sequence Info:full length protein