Recombinant Rat Insulin-1(Ins1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Insulin-1(Ins1),partial

CSB-EP355622RA-GB
Regular price
$775.00 USD
Sale price
$775.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01322

Gene Names: Ins1

Organism: Rattus norvegicus (Rat)

AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKS

Expression Region: 25-54aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.4 kDa

Alternative Name(s): Ins-1

Relevance: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Reference: "Primary structures of the proinsulin connecting peptides of the rat and the horse." Tager H.S., Steiner D.F. J. Biol. Chem. 247:7936-7940(1972)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share