![Recombinant Rat Allograft inflammatory factor 1(Aif1)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_a03e6a36-ee64-47ee-823d-a3280678d339_{width}x.jpg?v=1659191503)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: P55009
Gene Names: Aif1
Organism: Rattus norvegicus (Rat)
AA Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Expression Region: 2-147aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.7 kDa
Alternative Name(s): Ionized calcium-binding adapter molecule 1;MRF-1;Microglia response factor
Relevance: Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation .
Reference: The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.