Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Raphanus sativus (Radish)
Uniprot NO.:P14584
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLASLT DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNF VPGK
Protein Names:Recommended name: Chlorophyll a-b binding of LHCII type 1 protein Alternative name(s): Chlorophyll a-b binding of LHCII type I protein Short name= CAB Short name= LHCP
Gene Names:
Expression Region:1-124
Sequence Info:full length protein