Recombinant Rabbit Integrin beta-8(ITGB8),partial

Recombinant Rabbit Integrin beta-8(ITGB8),partial

CSB-EP011892RB
Regular price
$810.00 USD
Sale price
$810.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Signal Transduction

Target / Protein: ITGB8

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Oryctolagus cuniculus (Rabbit)

Delivery time: 3-7 business days

Uniprot ID: P26013

AA Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 146-384aa

Protein length: Partial

MW: 31.9 kDa

Alternative Name(s):

Relevance: Integrin alpha-V/beta-8 is a receptor for fibronectin.

Reference: "Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658(1991)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.