Recombinant Pseudomonas aeruginosa  Membrane protein glpM(glpM)

Recombinant Pseudomonas aeruginosa Membrane protein glpM(glpM)

CSB-CF346347EZX
Regular price
$1,072.00 USD
Sale price
$1,072.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:P52112

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFKALIGAAVVVLLAVLSKTRNYYIAGLVPLFPTFALIAHYIVGKGRSLDDLKTTIVFGM WSIIPYFVYLAALYLLVERFRLETSLALAALAWLVAASVLVGLWVRLHA

Protein Names:Recommended name: Membrane protein glpM

Gene Names:Name:glpM Ordered Locus Names:PA3585

Expression Region:1-109

Sequence Info:full length protein