
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Polaromonas naphthalenivorans (strain CJ2)
Uniprot NO.:A1VI80
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKYAIIFAVISLIAGALGFSGVAAGAAGIAKVLFGLFLILAVIFIVLAALGVGAAKKMM K
Protein Names:Recommended name: UPF0391 membrane protein Pnap_0032
Gene Names:Ordered Locus Names:Pnap_0032
Expression Region:1-61
Sequence Info:full length protein
You may also like
-
Recombinant Polaromonas naphthalenivorans UPF0060 membrane protein Pnap_4944 (Pnap_4944)
- Regular price
- $1,553.00 USD
- Sale price
- $1,553.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066(Bpro_0066)
- Regular price
- $1,497.00 USD
- Sale price
- $1,497.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant UPF0060 membrane protein XOO1791(XOO1791)
- Regular price
- $1,555.00 USD
- Sale price
- $1,555.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acaryochloris marina UPF0391 membrane protein AM1_5042 (AM1_5042)
- Regular price
- $1,504.00 USD
- Sale price
- $1,504.00 USD
- Regular price
-
- Unit price
- per
Sold out