Recombinant Polaromonas naphthalenivorans UPF0391 membrane protein Pnap_0032 (Pnap_0032)

CSB-CF380743PYT

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Polaromonas naphthalenivorans (strain CJ2)

Uniprot NO.:A1VI80

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKYAIIFAVISLIAGALGFSGVAAGAAGIAKVLFGLFLILAVIFIVLAALGVGAAKKMM K

Protein Names:Recommended name: UPF0391 membrane protein Pnap_0032

Gene Names:Ordered Locus Names:Pnap_0032

Expression Region:1-61

Sequence Info:full length protein