
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pisum sativum (Garden pea)
Uniprot NO.:P04159
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSI LAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNG RLAMFSMFGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein AB96 Alternative name(s): LHCII type I CAB-AB96 Short name= LHCP Major 15
Gene Names:Name:AB96
Expression Region:1-228
Sequence Info:full length protein
You may also like
-
Recombinant Pisum sativum Chlorophyll a-b binding protein 8, chloroplastic(CAB8)
- Regular price
- $1,688.00 USD
- Sale price
- $1,688.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pisum sativum Chlorophyll a-b binding protein 215, chloroplastic(CAB215)
- Regular price
- $1,684.00 USD
- Sale price
- $1,684.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pisum sativum Cytochrome b6(petB)
- Regular price
- $1,669.00 USD
- Sale price
- $1,669.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A, chloroplastic
- Regular price
- $1,689.00 USD
- Sale price
- $1,689.00 USD
- Regular price
-
- Unit price
- per
Sold out