
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:P00411
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLLFNNLIMNFDAPSPWGIYFQDSATPQMEGLVELHDNIMYYLVVILFGVGWILLSIIR NYISTKSPISHKYLNHGTLIELIWTITPAVILILIAFPSFKLLYLMDEVSDPSMSVLAEG HQWYWSYQYPDFLDSNDEFIEFDSYIVPESDLEEGALRMLEVDNRVILPELTHVRFIITA GDVIHSFAVPSLGVKCDAYPGRLNQVSVFINREGVFYGQCSEICGILHSSMPIVIESVSL EKFLTWLEEQ
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:cox-2 Synonyms:cox2, oxi1 ORF Names:NCM018, NCU16028
Expression Region:1-250
Sequence Info:full length protein
You may also like
-
Recombinant Neurospora crassa Cytochrome c oxidase subunit 3(cox-3)
- Regular price
- $1,383.00 USD
- Sale price
- $1,383.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(cox-2)
- Regular price
- $1,349.00 USD
- Sale price
- $1,349.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(COX2)
- Regular price
- $1,370.00 USD
- Sale price
- $1,370.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Caenorhabditis remanei Cytochrome c oxidase subunit 2(cox-2)
- Regular price
- $1,348.00 USD
- Sale price
- $1,348.00 USD
- Regular price
-
- Unit price
- per
Sold out