
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Penicillium marneffei
Uniprot NO.:Q6V9E0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFSIFLFLIGILGFVLNRKNIILMLISIEIMLLAITFLILISSFNFDDILGQTFAIYII TIAGAESAIGLGILVAYYRLRGSISIQYK
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L
Gene Names:Name:nd4L Synonyms:nad4L
Expression Region:1-89
Sequence Info:full length protein
You may also like
-
Recombinant NADH-ubiquinone oxidoreductase chain 4L(nd4l)
- Regular price
- $1,516.00 USD
- Sale price
- $1,516.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-ubiquinone oxidoreductase chain 4L(ND4L)
- Regular price
- $1,541.00 USD
- Sale price
- $1,541.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-ubiquinone oxidoreductase chain 4L(nd4L)
- Regular price
- $1,530.00 USD
- Sale price
- $1,530.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-ubiquinone oxidoreductase chain 4L(ND4L)
- Regular price
- $1,543.00 USD
- Sale price
- $1,543.00 USD
- Regular price
-
- Unit price
- per
Sold out