Recombinant Mouse Uroplakin-3a(Upk3a),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Uroplakin-3a(Upk3a),partial

CSB-EP862403MO
Regular price
$903.00 USD
Sale price
$903.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Tags & Cell Markers

Uniprot ID: Q9JKX8

Gene Names: Upk3a

Organism: Mus musculus (Mouse)

AA Sequence: VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG

Expression Region: 19-207aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 25.5 kDa

Alternative Name(s): Uroplakin III Short name: UPIII Upk3

Relevance: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence

Reference: "Origin of the tetraspanin uroplakins and their co-evolution with associated proteins: implications for uroplakin structure and function." Garcia-Espana A., Chung P.-J., Zhao X., Lee A., Pellicer A., Yu J., Sun T.-T., Desalle R. Mol. Phylogenet. Evol. 41:355-367(2006)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share