Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1(Cnep1r1)

Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1(Cnep1r1)

CSB-CF663664MO
Regular price
$1,103.00 USD
Sale price
$1,103.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q3UJ81

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ

Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 Short name= NEP1-R1 Alternative name(s): Transmembrane protein 188

Gene Names:Name:Cnep1r1 Synonyms:Tmem188

Expression Region:1-125

Sequence Info:full length protein