
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P28665
Gene Names: Mug1
Organism: Mus musculus (Mouse)
AA Sequence: TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE
Expression Region: 700-910aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 27 kDa
Alternative Name(s):
Relevance: A proteinase activates the inhibitor by specific proteolysis in the bait region, which, by an unknown mechanism leads to reaction at the cysteinyl-glutamyl internal thiol ester site and to a conformational change, whereby the proteinase is trapped and/or covalently bound to the inhibitor. While in the tetrameric proteinase inhibitors steric inhibition is sufficiently strong, monomeric forms need a covalent linkage between the activated glutamyl residue of the original thiol ester and a terminal amino group of a lysine or another nucleophilic group on the proteinase, for inhibition to be effective.
Reference: Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)
- Regular price
- $773.00 USD
- Sale price
- $773.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
- Regular price
- $770.00 USD
- Sale price
- $770.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
- Regular price
- $770.00 USD
- Sale price
- $770.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
- Regular price
- $773.00 USD
- Sale price
- $773.00 USD
- Regular price
-
- Unit price
- per
Sold out