Recombinant Mouse Histone H2B type 1-M(Hist1h2bm)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Histone H2B type 1-M(Hist1h2bm)

CSB-EP010413MO
Regular price
$768.00 USD
Sale price
$768.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P10854

Gene Names: Hist1h2bm

Organism: Mus musculus (Mouse)

AA Sequence: PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Expression Region: 2-126aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 17.8 kDa

Alternative Name(s): H2B 291B

Relevance: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.

Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Histone H2A type 1(HIST1H2AG)
    Regular price
    $601.00 USD
    Sale price
    $601.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Histone H2B type 1-N(HIST1H2BN)
    Regular price
    $601.00 USD
    Sale price
    $601.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Histone H2A.Z(H2AFZ)
    Regular price
    $601.00 USD
    Sale price
    $601.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Histone H2A.V(H2AFV)
    Regular price
    $601.00 USD
    Sale price
    $601.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share