Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P43006
Gene Names: Slc1a2
Organism: Mus musculus (Mouse)
AA Sequence: HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG
Expression Region: 143-238aa
Sequence Info: Extracellular Domain
Source: Yeast
Tag Info: N-terminal GST-tagged
MW: 37.6 kDa
Alternative Name(s): GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2
Relevance: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
Reference: Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.J. Proteome Res. 7:311-318(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.