
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cardiovascular
Target / Protein: Ang4
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q3TMQ6
AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Tag info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 25-144aa
Protein length: Full Length of Mature Protein
MW: 31.4 kDa
Alternative Name(s):
Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Reference: "Identification of a purine-rich intronic enhancer element in the mouse eosinophil-associated ribonuclease 2 (mEar 2) gene." Dyer K.D., Nitto T., Moreau J.M., McDevitt A.L., Rosenberg H.F. Mamm. Genome 15:126-134(2004)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- $971.00 USD
- Sale price
- $971.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- $968.00 USD
- Sale price
- $968.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- $968.00 USD
- Sale price
- $968.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- $968.00 USD
- Sale price
- $968.00 USD
- Regular price
-
- Unit price
- per
Sold out