
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q8VD53
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCF NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRN DRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLF SGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPE QGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT
Protein Names:Recommended name: Alkaline ceramidase 2 Short name= AlkCDase 2 Short name= Alkaline CDase 2 Short name= maCER2 EC= 3.5.1.23 Alternative name(s): Acylsphingosine deacylase 3-like Cancer-related gene liver 1 protein
Gene Names:Name:Acer2 Synonyms:Asah3l
Expression Region:1-275
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Alkaline ceramidase 1(Acer1)
- Regular price
- $1,399.00 USD
- Sale price
- $1,399.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Alkaline ceramidase 2(ACER2)
- Regular price
- $1,401.00 USD
- Sale price
- $1,401.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Alkaline ceramidase 3(Acer3)
- Regular price
- $1,394.00 USD
- Sale price
- $1,394.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Alkaline ceramidase 1(ACER1)
- Regular price
- $1,391.00 USD
- Sale price
- $1,391.00 USD
- Regular price
-
- Unit price
- per
Sold out