
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q60994
Gene Names: Adipoq
Organism: Mus musculus (Mouse)
AA Sequence: KGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Expression Region: 104-247aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 20.5 kDa
Alternative Name(s): 30KDA adipocyte complement-related protein;Adipocyte complement-related 30KDA protein ;ACRP30Adipocyte, C1q and collagen domain-containing protein;Adipocyte-specific protein AdipoQ
Relevance: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Reference: Testosterone selectively reduces the high molecular weight form of adiponectin by inhibiting its secretion from adipocytes.Xu A., Chan K.W., Hoo R.L.C., Wang Y., Tan K.C.B., Zhang J., Chen B., Lam M.C., Tse C., Cooper G.J.S., Lam K.S.L.J. Biol. Chem. 280:18073-18080(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Adiponectin(Adipoq)
- Regular price
- $779.00 USD
- Sale price
- $779.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Adipoq Antibody - Cat. #: CSB-PA07946A0Rb
- Regular price
- $371.00 USD
- Sale price
- $371.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Adiponectin(ADIPOQ)
- Regular price
- $916.00 USD
- Sale price
- $916.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Adiponectin(ADIPOQ)
- Regular price
- $1,004.00 USD
- Sale price
- $1,004.00 USD
- Regular price
-
- Unit price
- per
Sold out