
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Uniprot NO.:Q58975
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLIKILEEKLMELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFVWGFVVIFLVFP EFFGYVAEVLGVGRGVDALIYISIVVLFYLIYRLYAKINNLERQITHIVREIAIRDRYEP KKRD
Protein Names:Recommended name: Uncharacterized protein MJ1580
Gene Names:Ordered Locus Names:MJ1580
Expression Region:1-124
Sequence Info:full length protein
You may also like
-
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516(MJ1516)
- Regular price
- $1,222.00 USD
- Sale price
- $1,222.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1588(MJ1588)
- Regular price
- $1,233.00 USD
- Sale price
- $1,233.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1570(MJ1570)
- Regular price
- $1,236.00 USD
- Sale price
- $1,236.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405(MJ0405)
- Regular price
- $1,250.00 USD
- Sale price
- $1,250.00 USD
- Regular price
-
- Unit price
- per
Sold out