
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Stem Cells
Uniprot ID: O35735
Gene Names: IFNG
Organism: Marmota monax (Woodchuck)
AA Sequence: QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK
Expression Region: 24-166aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 18.6 kDa
Alternative Name(s): Short name: IFN-gamma
Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reference: "Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Marmota monax Interferon gamma(IFNG)
- Regular price
- $905.00 USD
- Sale price
- $905.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Marmota monax Interferon gamma(IFNG)
- Regular price
- $993.00 USD
- Sale price
- $993.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon gamma(IFNG)
- Regular price
- $874.00 USD
- Sale price
- $874.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep Interferon gamma(IFNG)
- Regular price
- $993.00 USD
- Sale price
- $993.00 USD
- Regular price
-
- Unit price
- per
Sold out