Recombinant Marmota monax Interferon gamma(IFNG)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Marmota monax Interferon gamma(IFNG)

CSB-YP011050MQG-GB
Regular price
$993.00 USD
Sale price
$993.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Stem Cells

Uniprot ID: O35735

Gene Names: IFNG

Organism: Marmota monax (Woodchuck)

AA Sequence: QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Expression Region: 24-166aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 18.6 kDa

Alternative Name(s): Short name: IFN-gamma

Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Reference: "Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Marmota monax Interferon gamma(IFNG)
    Regular price
    $905.00 USD
    Sale price
    $905.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Marmota monax Interferon gamma(IFNG)
    Regular price
    $993.00 USD
    Sale price
    $993.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interferon gamma(IFNG)
    Regular price
    $874.00 USD
    Sale price
    $874.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Sheep Interferon gamma(IFNG)
    Regular price
    $993.00 USD
    Sale price
    $993.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share