
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Magnetococcus sp. (strain MC-1)
Uniprot NO.:A0LDR7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLNAYLVLAAMLFTIGVFGIFLNRKNVISIMMSIELMLLAVNINFVAFSHYLHDLTGQI FTFFVVTVAAAEAAIGLAILVTFFRNRTTINVEEIDTLKG
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K
Gene Names:Name:nuoK Ordered Locus Names:Mmc1_3625
Expression Region:1-100
Sequence Info:full length protein
You may also like
-
Recombinant Mycobacterium sp. NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- $1,538.00 USD
- Sale price
- $1,538.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- $1,541.00 USD
- Sale price
- $1,541.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rhodococcus sp. NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- $1,538.00 USD
- Sale price
- $1,538.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Methylobacterium sp. NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- $1,541.00 USD
- Sale price
- $1,541.00 USD
- Regular price
-
- Unit price
- per
Sold out