
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Uniprot NO.:A4RI25
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPTTGPPPPLPGDRPLPSSFDNDEDFYNENGFQKIARKLKQEPLVPLGCVLTVAAFTGAY RAMRAGDHGRVNRMFRYRIAAQGFTILAMVAGGIYYSDDRHKEREMWKAKRDADEEEKRL KWIKELEARDEEDKLAKEIMDKRRQRAAAAAAKREGRAVEDKAAEGGAAAAQDAKSSSGL SWASAPGWFGGNKNEPDANAQTNTGDAEKPSEK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 ORF Names:MGG_07223
Expression Region:1-213
Sequence Info:full length protein
You may also like
-
Recombinant Magnaporthe oryzae Protein GET1(GET1)
- Regular price
- $1,334.00 USD
- Sale price
- $1,334.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Magnaporthe oryzae Protein YOP1(YOP1)
- Regular price
- $1,293.00 USD
- Sale price
- $1,293.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
- Regular price
- $1,285.00 USD
- Sale price
- $1,285.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Magnaporthe oryzae Assembly factor CBP4(CBP4)
- Regular price
- $1,258.00 USD
- Sale price
- $1,258.00 USD
- Regular price
-
- Unit price
- per
Sold out