
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: P39
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV)
Delivery time: 3-7 business days
Uniprot ID: P35840
AA Sequence: MALVSGALSTNRLRNYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARIWTTDDVNVAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGLVANVQLYNPVVPRYRSTFNENVLHVENVLKFKGNANALQKSLSRYEPYPIVVPLMLGTQTLNTSSAYKQFTVPTRDDFAALNQRTGAAAAAPPAPAAAPAGPRPAAELEYDETLDRFARWRAR
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-356aa
Protein length: Full Length
MW: 44.6 kDa
Alternative Name(s):
Relevance: Expressed late in infection.
Reference: "Nucleotide sequence of the p39-capsid gene region of the Lymantria dispar nuclear polyhedrosis virus." Bjoernson R.M., Rohrmann G.F. J. Gen. Virol. 73:1505-1508(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein(P39)
- Regular price
- $776.00 USD
- Sale price
- $776.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human parvovirus B19 Non-capsid protein NS-1(NS1),partial
- Regular price
- $912.00 USD
- Sale price
- $912.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bunyavirus La Crosse Nucleoprotein(N)
- Regular price
- $1,001.00 USD
- Sale price
- $1,001.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Nucleolin(NCL),Partial
- Regular price
- $678.00 USD
- Sale price
- $678.00 USD
- Regular price
-
- Unit price
- per
Sold out