
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: O43715
Gene Names: TRIAP1
Organism: Homo sapiens (Human)
AA Sequence: MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
Expression Region: 1-76aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35.8 kDa
Alternative Name(s): Protein 15E1.1 WF-1 p53-inducible cell-survival factor
Relevance: Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis
Reference: "p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway." Park W.-R., Nakamura Y. Cancer Res. 65:1197-1206(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Mitochondrial carnitine-acylcarnitine carrier protein(SLC25A20)
- Regular price
- $970.00 USD
- Sale price
- $970.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human p53-regulated apoptosis-inducing protein 1(TP53AIP1)
- Regular price
- $758.00 USD
- Sale price
- $758.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human p53 and DNA damage-regulated protein 1(PDRG1)
- Regular price
- $758.00 USD
- Sale price
- $758.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human p53 apoptosis effector related to PMP-22(PERP)
- Regular price
- $1,124.00 USD
- Sale price
- $1,124.00 USD
- Regular price
-
- Unit price
- per
Sold out