
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Apoptosis
Uniprot ID: P61289
Gene Names: PSME3
Organism: Homo sapiens (Human)
AA Sequence: ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET
Expression Region: 2-252aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 56.1 kDa
Alternative Name(s): 11S regulator complex subunit gamma ;REG-gammaActivator of multicatalytic protease subunit 3Ki nuclear autoantigen;Proteasome activator 28 subunit gamma ;PA28g ;PA28gamma
Relevance: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation.
Reference: Cloning and nucleotide sequence of cDNA for Ki antigen, a highly conserved nuclear protein detected with sera from patients with systemic lupus erythematosus.Nikaido T., Shimada K., Shibata M., Hata M., Sakamoto M., Takasaki Y., Sato C., Takahashi T., Nishida Y.Clin. Exp. Immunol. 79:209-214(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
PSME3 Antibody - Cat. #: CSB-PA13674A0Rb
- Regular price
- $369.00 USD
- Sale price
- $369.00 USD
- Regular price
-
- Unit price
- per
Sold out -
PSME3 Antibody, FITC conjugated - Cat. #: CSB-PA13674C0Rb
- Regular price
- $369.00 USD
- Sale price
- $369.00 USD
- Regular price
-
- Unit price
- per
Sold out -
PSME3 Antibody, HRP conjugated - Cat. #: CSB-PA13674B0Rb
- Regular price
- $369.00 USD
- Sale price
- $369.00 USD
- Regular price
-
- Unit price
- per
Sold out -
PSME3 Antibody, Biotin conjugated - Cat. #: CSB-PA13674D0Rb
- Regular price
- $369.00 USD
- Sale price
- $369.00 USD
- Regular price
-
- Unit price
- per
Sold out