Recombinant Human Proteasome activator complex subunit 3(PSME3),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Proteasome activator complex subunit 3(PSME3),partial

CSB-RP136744h
Regular price
$606.00 USD
Sale price
$606.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: P61289

Gene Names: PSME3

Organism: Homo sapiens (Human)

AA Sequence: ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET

Expression Region: 2-252aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 56.1 kDa

Alternative Name(s): 11S regulator complex subunit gamma ;REG-gammaActivator of multicatalytic protease subunit 3Ki nuclear autoantigen;Proteasome activator 28 subunit gamma ;PA28g ;PA28gamma

Relevance: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation.

Reference: Cloning and nucleotide sequence of cDNA for Ki antigen, a highly conserved nuclear protein detected with sera from patients with systemic lupus erythematosus.Nikaido T., Shimada K., Shibata M., Hata M., Sakamoto M., Takasaki Y., Sato C., Takahashi T., Nishida Y.Clin. Exp. Immunol. 79:209-214(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • PSME3 Antibody - Cat. #: CSB-PA13674A0Rb
    Regular price
    $369.00 USD
    Sale price
    $369.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • PSME3 Antibody, FITC conjugated - Cat. #: CSB-PA13674C0Rb
    Regular price
    $369.00 USD
    Sale price
    $369.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • PSME3 Antibody, HRP conjugated - Cat. #: CSB-PA13674B0Rb
    Regular price
    $369.00 USD
    Sale price
    $369.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • PSME3 Antibody, Biotin conjugated - Cat. #: CSB-PA13674D0Rb
    Regular price
    $369.00 USD
    Sale price
    $369.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share