Recombinant Human Myeloid cell surface antigen CD33(CD33),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Myeloid cell surface antigen CD33(CD33),partial

CSB-EP004925HU
Regular price
$972.00 USD
Sale price
$972.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P20138

Gene Names: CD33

Organism: Homo sapiens (Human)

AA Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Expression Region: 48-259aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 46.7 kDa

Alternative Name(s): Sialic acid-binding Ig-like lectin 3 Short name: Siglec-3 gp67 CD_antigen: CD33 SIGLEC3

Relevance: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia

Reference: "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing." Hernandez-Caselles T., Martinez-Esparza M., Perez-Oliva A.B., Quintanilla-Cecconi A.M., Garcia-Alonso A., Alvarez-Lopez D.M., Garcia-Penarrubia P. J. Leukoc. Biol. 79:46-58(2006)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Myeloid cell surface antigen CD33(CD33)
    Regular price
    $1,823.00 USD
    Sale price
    $1,823.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Myeloid cell surface antigen CD33(CD33),partial (Active)
    Regular price
    $338.00 USD
    Sale price
    $338.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Sialic acid-binding Ig-like lectin 15(SIGLEC15),partial
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15),partial
    Regular price
    $628.00 USD
    Sale price
    $628.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share