Recombinant Human Macrophage migration inhibitory factor(MIF)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Macrophage migration inhibitory factor(MIF)

CSB-RP068674h
Regular price
$758.00 USD
Sale price
$758.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P14174

Gene Names: MIF

Organism: Homo sapiens (Human)

AA Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Expression Region: 2-115aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.3 kDa

Alternative Name(s): Glycosylation-inhibiting factor ;GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomerase

Relevance: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

Reference: Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.Weiser W.Y., Temple P.A., Witek-Giannotti J.S., Remold H.G., Clark S.C., David J.R.Proc. Natl. Acad. Sci. U.S.A. 86:7522-7526(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Macrophage migration inhibitory factor(Mif)
    Regular price
    $426.00 USD
    Sale price
    $426.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • MIF Antibody, FITC conjugated - Cat. #: CSB-PA06867C0Rb
    Regular price
    $399.00 USD
    Sale price
    $399.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • MIF Antibody, HRP conjugated - Cat. #: CSB-PA06867B0Rb
    Regular price
    $399.00 USD
    Sale price
    $399.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • MIF Antibody, Biotin conjugated - Cat. #: CSB-PA06867D0Rb
    Regular price
    $399.00 USD
    Sale price
    $399.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share