Recombinant Human Eukaryotic translation initiation factor 1(EIF1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Eukaryotic translation initiation factor 1(EIF1)

CSB-RP051144h
Regular price
$602.00 USD
Sale price
$602.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: P41567

Gene Names: EIF1

Organism: Homo sapiens (Human)

AA Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Expression Region: 1-113aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.7 kDa

Alternative Name(s): A121;Protein translation factor SUI1 homologSui1iso1

Relevance: Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Reference: Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share