
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Developmental Biology
Target / Protein: DLL3
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q9NYJ7
AA Sequence: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Tag info: N-terminal 6xHis-tagged
Expression Region: 27-492aa
Protein length: Extracellular Domain
MW: 50.5 kDa
Alternative Name(s): Drosophila Delta homolog 3 ;Delta3
Relevance: Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm .
Reference: Mutations in the human delta homologue, DLL3, cause axial skeletal defects in spondylocostal dysostosis.Bulman M.P., Kusumi K., Frayling T.M., McKeown C., Garrett C., Lander E.S., Krumlauf R., Hattersley A.T., Ellard S., Turnpenny P.D.Nat. Genet. 24:438-441(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- $677.00 USD
- Sale price
- $677.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Delta-like protein 3(DLL3),partial
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Delta-like protein 3(DLL3),partial (Active)
- Regular price
- $464.00 USD
- Sale price
- $464.00 USD
- Regular price
-
- Unit price
- per
Sold out