Recombinant Human Collagen alpha-1(IV) chain(COL4A1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Collagen alpha-1(IV) chain(COL4A1),partial

CSB-RP114644h
Regular price
$760.00 USD
Sale price
$760.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P02462

Gene Names: COL4A1

Organism: Homo sapiens (Human)

AA Sequence: GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Expression Region: 30-167aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.9 kDa

Alternative Name(s):

Relevance: Type IV collagen is the major structural component of glomerular basent mbranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.

Reference: Structural organization of the gene for the alpha 1 chain of human type IV collagen.Soininen R., Huotari M., Ganguly A., Prockop D.J., Tryggvason K.J. Biol. Chem. 264:13565-13571(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Collagen alpha-1(IV) chain(COL4A1) ,partial
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Collagen alpha-3(IV) chain(COL4A3),partial
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Collagen alpha-2(IV) chain(COL4A2),partial
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Collagen alpha-2(IV) chain(COL4A2),partial
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share