Recombinant Human Apolipoprotein B-100(APOB),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Apolipoprotein B-100(APOB),partial

CSB-YP001918HU
Regular price
$848.00 USD
Sale price
$848.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cardiovascular

Uniprot ID: P04114

Gene Names: APOB

Organism: Homo sapiens (Human)

AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Expression Region: 28-127aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 13.2 kDa

Alternative Name(s): Apolipoprotein B-48 Short name: Apo B-48

Relevance: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Reference: "Complete cDNA and derived protein sequence of human apolipoprotein B-100."Knott T.C., Wallis S.C., Powell L.M., Pease R.J., Lusis A.J., Blackhart B., McCarthy B.J., Mahley R.W., Levy-Wilson B., Scott J.Nucleic Acids Res. 14:7501-7503(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Apolipoprotein B
    Regular price
    $717.00 USD
    Sale price
    $717.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Apolipoprotein M(APOM)
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Apolipoprotein A-IV(APOA4)
    Regular price
    $760.00 USD
    Sale price
    $760.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human APOB
    Regular price
    $609.00 USD
    Sale price
    $609.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share