Recombinant Human Antigen KI-67(MKI67),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Antigen KI-67(MKI67),partial

CSB-YP014597HU
Regular price
$845.00 USD
Sale price
$845.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Cycle

Uniprot ID: P46013

Gene Names: MKI67

Organism: Homo sapiens (Human)

AA Sequence: NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Expression Region: 3120-3256aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17.3 kDa

Alternative Name(s):

Relevance: Thought to be required for maintaining cell proliferation.

Reference: A novel nucleolar protein, NIFK, interacts with the forkhead associated domain of Ki-67 antigen in mitosis.Takagi M., Sueishi M., Saiwaki T., Kametaka A., Yoneda Y.J. Biol. Chem. 276:25386-25391(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Antigen KI-67(MKI67),partial
    Regular price
    $757.00 USD
    Sale price
    $757.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Antigen KI-67(MKI67) ,partial
    Regular price
    $757.00 USD
    Sale price
    $757.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Antigen KI-67(MKI67) ,partial
    Regular price
    $757.00 USD
    Sale price
    $757.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human N-myc proto-oncogene protein(MYCN)
    Regular price
    $845.00 USD
    Sale price
    $845.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share