Recombinant Hepatitis delta virus genotype I Small delta antigen

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Hepatitis delta virus genotype I Small delta antigen

CSB-YP361989HFN
Regular price
$880.00 USD
Sale price
$880.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P06934

Gene Names: N/A

Organism: Hepatitis delta virus genotype I (isolate Italian) (HDV)

AA Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP

Expression Region: 1-195aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

MW: 25.4 kDa

Alternative Name(s): p24

Relevance: Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome

Reference: "Characterization of hepatitis delta antigen: specific binding to hepatitis delta virus RNA." Lin J.-H., Chang M.F., Baker S.C., Govindarajan S., Lai M.M.C. J. Virol. 64:4051-4058(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share