
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain J99) (Campylobacter pylori J99)
Uniprot NO.:P64652
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE QK
Protein Names:Recommended name: Uncharacterized protein jhp_0078
Gene Names:Ordered Locus Names:jhp_0078
Expression Region:1-62
Sequence Info:full length protein
You may also like
-
Recombinant Helicobacter pylori Uncharacterized protein HP_0085 (HP_0085)
- Regular price
- $1,498.00 USD
- Sale price
- $1,498.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori UPF0114 protein HP_0189 (HP_0189)
- Regular price
- $1,629.00 USD
- Sale price
- $1,629.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori UPF0114 protein HPAG1_0183(HPAG1_0183)
- Regular price
- $1,629.00 USD
- Sale price
- $1,629.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)
- Regular price
- $1,558.00 USD
- Sale price
- $1,558.00 USD
- Regular price
-
- Unit price
- per
Sold out