Recombinant Helicobacter pylori  Uncharacterized protein jhp_0078 (jhp_0078)

Recombinant Helicobacter pylori Uncharacterized protein jhp_0078 (jhp_0078)

CSB-CF353759HCQ
Regular price
$1,063.00 USD
Sale price
$1,063.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain J99) (Campylobacter pylori J99)

Uniprot NO.:P64652

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE QK

Protein Names:Recommended name: Uncharacterized protein jhp_0078

Gene Names:Ordered Locus Names:jhp_0078

Expression Region:1-62

Sequence Info:full length protein