
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Uniprot NO.:P59841
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTKRKAYVREMKANWWTKLDFYRMYMIREATCIATIWFCLVLLYGVISLGGRHIENFIS FSQNPLVVILNIISLAGLLYHAATLYVMTPQVLTIVVKNERLNPNILKNALWAITGLVSL LALVLVYI
Protein Names:Recommended name: Fumarate reductase subunit C
Gene Names:Name:frdC Ordered Locus Names:HD_0033
Expression Region:1-128
Sequence Info:full length protein
You may also like
-
Recombinant Haemophilus ducreyi Fumarate reductase subunit D(frdD)
- Regular price
- $1,235.00 USD
- Sale price
- $1,235.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus influenzae Fumarate reductase subunit D(frdD)
- Regular price
- $1,235.00 USD
- Sale price
- $1,235.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus influenzae Fumarate reductase subunit C(frdC)
- Regular price
- $1,251.00 USD
- Sale price
- $1,251.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus influenzae Fumarate reductase subunit D(frdD)
- Regular price
- $1,235.00 USD
- Sale price
- $1,235.00 USD
- Regular price
-
- Unit price
- per
Sold out