
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P0C741
Gene Names: LMP1
Organism: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
AA Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Expression Region: 185-366aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
MW: 21.3 kDa
Alternative Name(s): Protein p63
Relevance: Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.
Reference: "Genomic sequence analysis of Epstein-Barr virus strain GD1 from a nasopharyngeal carcinoma patient." Zeng M.-S., Li D.-J., Liu Q.-L., Song L.-B., Li M.-Z., Zhang R.-H., Yu X.-J., Wang H.-M., Ernberg I., Zeng Y.-X. J. Virol. 79:15323-15330(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $994.00 USD
- Sale price
- $994.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $995.00 USD
- Sale price
- $995.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $771.00 USD
- Sale price
- $771.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
- Regular price
- $994.00 USD
- Sale price
- $994.00 USD
- Regular price
-
- Unit price
- per
Sold out