Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

CSB-YP314489EFC1b0
Regular price
$994.00 USD
Sale price
$994.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0C741

Gene Names: LMP1

Organism: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

AA Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Expression Region: 185-366aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

MW: 21.3 kDa

Alternative Name(s): Protein p63

Relevance: Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.

Reference: "Genomic sequence analysis of Epstein-Barr virus strain GD1 from a nasopharyngeal carcinoma patient." Zeng M.-S., Li D.-J., Liu Q.-L., Song L.-B., Li M.-Z., Zhang R.-H., Yu X.-J., Wang H.-M., Ernberg I., Zeng Y.-X. J. Virol. 79:15323-15330(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
    Regular price
    $994.00 USD
    Sale price
    $994.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
    Regular price
    $995.00 USD
    Sale price
    $995.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
    Regular price
    $771.00 USD
    Sale price
    $771.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial
    Regular price
    $994.00 USD
    Sale price
    $994.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share