Recombinant Enterobacter aerogenes  Ribitol 2-dehydrogenase(rbtD)

Recombinant Enterobacter aerogenes Ribitol 2-dehydrogenase(rbtD)

CSB-EP360400EKN
Regular price
$794.00 USD
Sale price
$794.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P00335

Gene Names: rbtD

Organism: Enterobacter aerogenes (Aerobacter aerogenes)

AA Sequence: MKHSVSSMNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKLNKLVAELGENAFALQVDLMQADQVDNLLQGILQLTGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAGVVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDDWPKAKMDEALANGSLMQPIEVAESVLFMVTRSKNVTVRDIVILPNSVDL

Expression Region: 1-249aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 30.5 kDa

Alternative Name(s):

Relevance:

Reference: Ribitol dehydrogenase of Klebsiella aerogenes. Sequence and properties of wild-type and mutant strains.Dothie J.M., Giglio J.R., Moore C.H., Taylor S.S., Hartley B.S.Biochem. J. 230:569-578(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.