Recombinant Chondrus crispus  Succinate dehydrogenase cytochrome b560 subunit(SDH3)

Recombinant Chondrus crispus Succinate dehydrogenase cytochrome b560 subunit(SDH3)

CSB-CF020908CJR
Regular price
$1,097.00 USD
Sale price
$1,097.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chondrus crispus (Carragheen moss) (Irish moss)

Uniprot NO.:P48934

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFIKFKISNRPIAPHLLVYTPQLSSLFSIWHRISGVGLAFFFTTFLIFIRIILSSNFACN LLTLISFEISQWIIIYFNLFILLFLFYHLFNGTRHIIWDFGFLLDIKYLSKFSLFLLVSL SLILIFQ

Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit Alternative name(s): Succinate dehydrogenase, subunit III

Gene Names:Name:SDH3 Synonyms:SDHC

Expression Region:1-127

Sequence Info:full length protein