Recombinant Caiman crocodilus  NADH-ubiquinone oxidoreductase chain 4(MT-ND4)

Recombinant Caiman crocodilus NADH-ubiquinone oxidoreductase chain 4(MT-ND4)

CSB-CF657750CAF-GB
Regular price
$1,081.00 USD
Sale price
$1,081.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caiman crocodilus (Spectacled caiman) (Caiman sclerops)

Uniprot NO.:Q34076

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GLQLTSPLLTAWWFLACSTNMALPPTINLSGELTLITSLFSWLDITVFLTGLSAFATTTY TLYMFSSTQQGTLPPNIKPSSPSQTREHFLMLLHLLPSAGLATNPKLTAPQ

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4

Gene Names:Name:MT-ND4 Synonyms:MTND4, NADH4, ND4

Expression Region:1-111

Sequence Info:full length protein