
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Uniprot NO.:Q9RPX7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGI GIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWY TLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRF AKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ
Protein Names:Recommended name: Type IV secretion system protein virB8
Gene Names:Name:virB8 Ordered Locus Names:BMEII0032
Expression Region:1-239
Sequence Info:full length protein
You may also like
-
Recombinant Brucella suis biovar 1 Type IV secretion system protein virB8(virB8)
- Regular price
- $1,347.00 USD
- Sale price
- $1,347.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB6(virB6)
- Regular price
- $1,443.00 USD
- Sale price
- $1,443.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB8(virB8)
- Regular price
- $1,347.00 USD
- Sale price
- $1,347.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3(virB3)
- Regular price
- $1,236.00 USD
- Sale price
- $1,236.00 USD
- Regular price
-
- Unit price
- per
Sold out