Recombinant Brucella melitensis biotype 1  Type IV secretion system protein virB3(virB3)

Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3(virB3)

CSB-CF882686BMO
Regular price
$1,077.00 USD
Sale price
$1,077.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Uniprot NO.:Q9RPY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Protein Names:Recommended name: Type IV secretion system protein virB3

Gene Names:Name:virB3 Ordered Locus Names:BMEII0027

Expression Region:1-116

Sequence Info:full length protein