Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4(NDUFB4)

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4(NDUFB4)

CSB-CF015651BO
Regular price
$1,103.00 USD
Sale price
$1,103.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P48305

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SFPKYEASRLSSLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYYDPSRRGVIE DPALVRWTYARSANIYPNFRPNTKTSLLGALFGIGPLVFWYYVFKTDRDRKEKLIQEGKL DRTFNISY

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 Alternative name(s): Complex I-B15 Short name= CI-B15 NADH-ubiquinone oxidoreductase B15 subunit

Gene Names:Name:NDUFB4

Expression Region:2-129

Sequence Info:Full length protein