Recombinant Bacillus cereus UPF0295 protein BCQ_0566 (BCQ_0566)

CSB-CF497665BQQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain Q1)

Uniprot NO.:B9J3N9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BCQ_0566

Gene Names:Ordered Locus Names:BCQ_0566

Expression Region:1-118

Sequence Info:full length protein