Recombinant Artemia salina  Cytochrome c oxidase subunit 3(COIII)

Recombinant Artemia salina Cytochrome c oxidase subunit 3(COIII)

CSB-CF655643AOE
Regular price
$1,095.00 USD
Sale price
$1,095.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Artemia salina (Brine shrimp)

Uniprot NO.:Q33845

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSALLNTSILLRSGVTVTWAHHALMENNFDQCLQGLLFTVLLGLYFSFLQGLEYMEASFT IADSIYGSTFFLATGFHGLHVLIGTIFLMICILRHLSATFSQHHFGFEAAAWYWH

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III

Gene Names:Name:COIII

Expression Region:1-115

Sequence Info:full length protein