Recombinant Actinobacillus pleuropneumoniae serotype 7  Large-conductance mechanosensitive channel(mscL)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Large-conductance mechanosensitive channel(mscL)

CSB-CF453374AXI
Regular price
$1,103.00 USD
Sale price
$1,103.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Actinobacillus pleuropneumoniae serotype 7 (strain AP76)

Uniprot NO.:B3H2I9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLIGGVDFKDLAIE IAPAKEGAEAVMLKYGAFIQNVFDFLIIAIAVFGMVKVINKIKKPAEAAPAEPTAEEKLL TEIRDLLKK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:APP7_1654

Expression Region:1-129

Sequence Info:full length protein

Your list is ready to share