Recombinant Acinetobacter baylyi  Catechol 1,2-dioxygenase(catA)

Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)

CSB-EP357202AWW
Regular price
$911.00 USD
Sale price
$911.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: catA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Acinetobacter baylyi

Delivery time: 3-7 business days

Uniprot ID: P07773

AA Sequence: MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-311aa

Protein length: Full Length

MW: 50.3 kDa

Alternative Name(s): 1,2-CTD

Relevance: Catechol + O2 = cis,cis-muconate.

Reference: "DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)
    Regular price
    $911.00 USD
    Sale price
    $911.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Acinetobacter calcoaceticus Catechol 1,2-dioxygenase
    Regular price
    $911.00 USD
    Sale price
    $911.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cathepsin O(CTSO)
    Regular price
    $551.00 USD
    Sale price
    $551.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cathepsin O(CTSO)
    Regular price
    $535.00 USD
    Sale price
    $535.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share