
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: catA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Acinetobacter baylyi
Delivery time: 3-7 business days
Uniprot ID: P07773
AA Sequence: MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-311aa
Protein length: Full Length
MW: 50.3 kDa
Alternative Name(s): 1,2-CTD
Relevance: Catechol + O2 = cis,cis-muconate.
Reference: "DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)
- Regular price
- $911.00 USD
- Sale price
- $911.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acinetobacter calcoaceticus Catechol 1,2-dioxygenase
- Regular price
- $911.00 USD
- Sale price
- $911.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin O(CTSO)
- Regular price
- $551.00 USD
- Sale price
- $551.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin O(CTSO)
- Regular price
- $535.00 USD
- Sale price
- $535.00 USD
- Regular price
-
- Unit price
- per
Sold out